PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa015105
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 398aa    MW: 45299 Da    PI: 5.7289
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-15506PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.35.5e-31214268155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                k+r+rWt++LH+rFve+v+ LGG+ekAtPk+il+lm+ +gLt+ hvkSHLQkYR+
  Lsa015105 214 KTRIRWTQDLHDRFVECVSCLGGAEKATPKAILKLMDSEGLTIFHVKSHLQKYRI 268
                68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.508211271IPR017930Myb domain
SuperFamilySSF466891.51E-16212268IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-27213269IPR009057Homeodomain-like
TIGRFAMsTIGR015575.4E-23214269IPR006447Myb domain, plants
PfamPF002491.3E-6218267IPR001005SANT/Myb domain
PfamPF143792.0E-16298344IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MNTLKVGYNH ETVYNLKARE FGGAAAVQQQ PWQVGITILP SEIEARDANL QEDQQQQIIN  60
YRQEVPSCSK TIMEQIGSPA SAVFATEKYL GFSQNGVRRS VHVNDETDVS SVPQQMRFDN  120
HFMHPHDNGI FSSYQRSSSF KMRSSNNQSE RDQIRELKRK LLDESDTSDW RQPQPSICFD  180
GNQDLGQGQF GRIRPASGQH SVNCTNPGNV MPSKTRIRWT QDLHDRFVEC VSCLGGAEKA  240
TPKAILKLMD SEGLTIFHVK SHLQKYRIAK YLPESGKGNS EKRTTMDTIS QIENISGMQF  300
KDALQMQLAV QRQLHEQLEI QRNLQLRIEE QAKQLKKMFN QHQQQKANKS QNSDITSSHD  360
DHHSTNLNDD DDDDDDDDDD ALNLDDDSAD TLFPSKIS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A103Y6P31e-164A0A103Y6P3_CYNCS; Homeodomain-like protein
STRINGVIT_08s0007g06310.t012e-77(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.11e-63G2-like family protein